PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676746982
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ZF-HD
Protein Properties Length: 319aa    MW: 36116.3 Da    PI: 7.6465
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676746982genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.17.7e-3291147360
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                   ++YkeClkNhAa +Gg+a+DGCgEfmps ge+g+++al+C+AC+CHRnFHR+eve e
    676746982  91 MIKYKECLKNHAAVMGGNATDGCGEFMPS-GEDGSIEALTCSACNCHRNFHRKEVEGE 147
                  689*************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2992154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.0E-2892144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.6E-3193144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.92694143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.19E-19211279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-29216280IPR009057Homeodomain-like
TIGRFAMsTIGR015658.5E-28221277IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MEIASQEDHD MPIPLNTTFV GGGGGHGHMI HHHHDHHAAN SAPPTHNNNN NITTTQPPQM  60
PLHGNGHGNN NDHHQQDPHH VGYNAIIKKP MIKYKECLKN HAAVMGGNAT DGCGEFMPSG  120
EDGSIEALTC SACNCHRNFH RKEVEGETTA TAISSYHQQP QPRKLMVNHH NIRSAMPHQM  180
IMPIGVSNYR YMHNSESDDF MEEDGVTTAS RPLPHPPYNQ KKRFRTKFTP EQKEKMLSFA  240
EKVGWKIQRQ EDSVVQRFCE EIGVKRRVLK VWMHNNKLHF SNKKINSNNI NLEDNHNEKS  300
NNVNNVDLSG NNDMTKIVP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A1e-232212771773ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742660.0AY074266.1 Arabidopsis thaliana unknown protein (At1g14440) mRNA, complete cds.
GenBankAY0967380.0AY096738.1 Arabidopsis thaliana unknown protein (At1g14440) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF14L170.0AC012188.2 Sequence of BAC F14L17 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009117900.10.0PREDICTED: zinc-finger homeodomain protein 4-like
RefseqXP_009117901.10.0PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotQ9M9S00.0ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A078D2V70.0A0A078D2V7_BRANA; BnaC08g39630D protein
TrEMBLA0A078IVY40.0A0A078IVY4_BRANA; BnaA09g57080D protein
TrEMBLM4EDH00.0M4EDH0_BRARP; Uncharacterized protein
STRINGBra026830.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33392665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-143homeobox protein 31